PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1277s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 262aa    MW: 29128.3 Da    PI: 7.5031
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1277s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85.1e-333588255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtp+LH++Fv+ave LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR 
  Araha.1277s0003.1.p 35 PRLRWTPDLHRCFVHAVEILGGQHRATPKLVLKMMDVKGLTISHVKSHLQMYRG 88
                         8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-303188IPR009057Homeodomain-like
PROSITE profilePS5129413.4053191IPR017930Myb domain
TIGRFAMsTIGR015574.6E-233588IPR006447Myb domain, plants
SuperFamilySSF466895.38E-153587IPR009057Homeodomain-like
PfamPF002499.6E-93687IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGKCGGRNGN GSFNGSGFHG HGGGRVRPYV RSPVPRLRWT PDLHRCFVHA VEILGGQHRA  60
TPKLVLKMMD VKGLTISHVK SHLQMYRGSK LTLGKPEESS SSSIRRRQDS EEDNLHDNLS  120
LPTRNDCLLG FHSFPLSSHS SFRGGGRRKE QQQTSESGYD DDDDFLHIMN MKKTKDTTTF  180
LSHHFPKGTE EWREQEHEEE EEDLSLSLSL NHHHWRSNGS SVSETSEAAV STCSAPFVSK  240
DCFGSSKIDL NLNLSISLLG S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2295110.0AK229511.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL17-14-B12.
GenBankBT0085560.0BT008556.1 Arabidopsis thaliana clone U50358 unknown protein (At2g02060) mRNA, complete cds.
GenBankBT0086990.0BT008699.1 Arabidopsis thaliana clone RAFL17-14-B12 (R50358) unknown protein (At2g02060) mRNA, complete cds.
GenBankKJ1389240.0KJ138924.1 Arabidopsis thaliana glycosyltransferase (AT2G02060) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875110.11e-143hypothetical protein ARALYDRAFT_484129
SwissprotQ700D93e-73MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLD7LPZ11e-143D7LPZ1_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.5__121__AT2G02060.11e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-59G2-like family protein